Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g080260.0.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 752aa    MW: 82221.9 Da    PI: 5.2773
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g080260.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++e+e++++++++p+ ++r+eL ++lgL+  qVk+WFqN+R+++k
                         688999***********************************************998 PP

               START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                         ela +a++el+++a+ eep+W  ss  e + ++e+ ++f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW++ +a    ka+
                         57899********************999999********99888********************************.************** PP

               START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                         tlev+s+g      galq+m+ae+q++splvp R+ +f+Ry++q+g+g+wv+vdvS+d+ + ++    v R++++pSg+li++++ng+s+v
                         **************************************************************97....8********************** PP

               START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         +wvehv+++++ +h ++++lv+sg+a+gak+wvatl+rqce+
                         ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.7157117IPR001356Homeobox domain
SMARTSM003897.9E-1658121IPR001356Homeobox domain
PfamPF000465.2E-1660115IPR001356Homeobox domain
CDDcd000864.20E-1660118No hitNo description
PROSITE profilePS5084847.22241471IPR002913START domain
SuperFamilySSF559611.58E-36242470No hitNo description
CDDcd088752.22E-125245467No hitNo description
SMARTSM002344.5E-63250468IPR002913START domain
PfamPF018521.6E-57251468IPR002913START domain
Gene3DG3DSA:3.30.530.202.2E-5317468IPR023393START-like domain
SuperFamilySSF559611.79E-24488719No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF5187800.0JF518780.1 UNVERIFIED: Solanum lycopersicum GL2 protein-like mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232734.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
RefseqXP_010316614.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLK4B9P70.0K4B9P7_SOLLC; Uncharacterized protein
STRINGSolyc02g080260.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2